CXCL8 Protein

ArtNr	OPCB00001
Hersteller	AVIVA Systems Biology
Menge	5 ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	other
Purity	> 97% as determined by SDS-PAGE
Sequence	SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Citations	1. "Interleukin-8, a chemotactic and inflammatory cytokine" Baggiolini M., Clark-Lewis I. FEBS Lett. 307:97-101(1992) 2. "Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction MDNCF mRNA by interleukin 1 and tumor necrosis factor" Matsushima K., Morishita K., Yoshimura T., Lavu S., Kobayashi Y., Lew W., Appella E., Kung H., Leonard E.J., Oppenheim J.J. J. Exp. Med. 167:1883-1893(1988) 3. "Chemokines, CXC\|IL-8" Strieter R.M., Keane M.P., Belperio J. A. Encyclopedia of respiratory medicine, Academic Press, Oxford, P395-398(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL8,NAF,GCP1,LECT,LUCT,NAP1,GCP-1,LYNAP,MDNCF,MONAP,NAP-1,SCYB8
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Wet Ice
Molecular Weight	8.386 kDa
Gene symbol	CXCL8
Gene Fullname	chemokine (C-X-C motif) ligand 8
Product format	Lyophilized
Reconstitution and storage	Spin tube prior to resuspending. Recommend to reconstitute at 100 ug/mL in sterile water. Stable for 1 month at -20C to -70C under sterile conditions after reconstitution; 12 months from date of receipt, -20C to -70C as supplied. Suggest to use immediately after reconstitution. Avoid repeated freeze/thaw cycles.
Description of target	Interleukin 8 (IL-8 )(CXCL8) is secreted primarily by macrophages and monocytes. It is one of the key mediators for inflammatory responses. IL-8 is a strong chemotractant for newtrophiles and monoccytes, and promotes activation of these target cells by binding to two cell surface receptors CXCR1 and CXCR2. It is also a strong angiogenic agent, and is considered to play a role in the pathogenesis of bronchiolitis.
Biological activity	EC50 = 0.083nM determined by Migration Assay in cells expressing recombinant CXCR1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPCB00001-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern