« Back
Home /
CXCL8 Protein

CXCL8 Protein

Item no.	OPCB00001
Manufacturer	AVIVA Systems Biology
Amount	5 ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
Purity	> 97% as determined by SDS-PAGE
Sequence	SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Citations	1. "Interleukin-8, a chemotactic and inflammatory cytokine" Baggiolini M., Clark-Lewis I. FEBS Lett. 307:97-101(1992) 2. "Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction MDNCF mRNA by interleukin 1 and tumor necrosis factor" Matsushima K., Morishita K., Yoshimura T., Lavu S., Kobayashi Y., Lew W., Appella E., Kung H., Leonard E.J., Oppenheim J.J. J. Exp. Med. 167:1883-1893(1988) 3. "Chemokines, CXC\|IL-8" Strieter R.M., Keane M.P., Belperio J. A. Encyclopedia of respiratory medicine, Academic Press, Oxford, P395-398(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL8,NAF,GCP1,LECT,LUCT,NAP1,GCP-1,LYNAP,MDNCF,MONAP,NAP-1,SCYB8
Shipping Condition	Cool pack
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Wet Ice
Molecular Weight	8.386 kDa
Gene symbol	CXCL8
Gene Fullname	chemokine (C-X-C motif) ligand 8
Product format	Lyophilized
Reconstitution and storage	Spin tube prior to resuspending. Recommend to reconstitute at 100 ug/mL in sterile water. Stable for 1 month at -20C to -70C under sterile conditions after reconstitution; 12 months from date of receipt, -20C to -70C as supplied. Suggest to use immediately after reconstitution. Avoid repeated freeze/thaw cycles.
Description of target	Interleukin 8 (IL-8 )(CXCL8) is secreted primarily by macrophages and monocytes. It is one of the key mediators for inflammatory responses. IL-8 is a strong chemotractant for newtrophiles and monoccytes, and promotes activation of these target cells by binding to two cell surface receptors CXCR1 and CXCR2. It is also a strong angiogenic agent, and is considered to play a role in the pathogenesis of bronchiolitis.
Biological activity	EC50 = 0.083nM determined by Migration Assay in cells expressing recombinant CXCR1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCB00001-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer