Vergleich

MECP2 Protein

ArtNr OPPA00195
Hersteller AVIVA Systems Biology
Menge 2 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Host Mammalian cells
Konjugat/Tag FLAG
Purity Greater than 80% as determined by SDS-PAGE.
Sequence MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Methyl CpG binding protein 2 (Rett syndrome),MeCp-2 protein,AUTSX3,MRX16,MRX79,MRXS13,MRXSL,PPMX,RTT,Mental retardation,X-linked 16,DKFZp686A24160.
Similar products MECP2
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal Flag tag
Shipping Temperature
Wet Ice
Molecular Weight
54 kDa
Gene symbol
MECP2
Protein size
Recombinant
Product format
Liquid 50mM Tris, 135mM NaCl, 20% glycerol (pH 7.5) and 200 ug/mL FLAG peptide
Reconstitution and storage
MECP2 although stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target
MECP2 is the key modificator of eukaryotic genomes and has a crucial part in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 form a family of nuclear proteins linked by the existence in each of a methyl-CpG binding domain (MBD). Each one of these proteins, with the exception of MBD3, can bind specifically to methylated DNA. In addition, MECP2, MBD1 and MBD2 can inhibit transcription from methylated gene promoters. Unlike other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is expendable in stem cells, but is vital for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common reasons of mental retardation in females.
Purification
Greater than 90% as determined by SDS-PAGE.
Formulation
The MECP2 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Concentration
0.45 mg/ml
Epitope
1-486aa

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 2 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen