Comparison

MECP2 Protein

Item no. OPPA00195
Manufacturer AVIVA Systems Biology
Amount 2 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Host Mammalian cells
Conjugate/Tag FLAG
Purity Greater than 80% as determined by SDS-PAGE.
Sequence MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Methyl CpG binding protein 2 (Rett syndrome),MeCp-2 protein,AUTSX3,MRX16,MRX79,MRXS13,MRXSL,PPMX,RTT,Mental retardation,X-linked 16,DKFZp686A24160.
Similar products MECP2
Shipping Condition Cool pack
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal Flag tag
Shipping Temperature
Wet Ice
Molecular Weight
54 kDa
Gene symbol
MECP2
Protein size
Recombinant
Product format
Liquid 50mM Tris, 135mM NaCl, 20% glycerol (pH 7.5) and 200 ug/mL FLAG peptide
Reconstitution and storage
MECP2 although stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target
MECP2 is the key modificator of eukaryotic genomes and has a crucial part in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 form a family of nuclear proteins linked by the existence in each of a methyl-CpG binding domain (MBD). Each one of these proteins, with the exception of MBD3, can bind specifically to methylated DNA. In addition, MECP2, MBD1 and MBD2 can inhibit transcription from methylated gene promoters. Unlike other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is expendable in stem cells, but is vital for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common reasons of mental retardation in females.
Purification
Greater than 90% as determined by SDS-PAGE.
Formulation
The MECP2 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Concentration
0.45 mg/ml
Epitope
1-486aa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 2 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close