Vergleich

Soybean P34 Protein

ArtNr OPPA00393
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Applikationen WB, ELISA
Specific against Glycine max
Konjugat/Tag HIS
Purity Protein is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.
Sequence MLTKFTTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMNANRKSPHSHRLGLNKFADITPQEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCDHPPASWDWRKKGVITQVKYQGGCGSGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGCYNGWHYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYT
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Soybean P34,Soybean P34 Protein Recombinant
Similar products Soy Bean P34
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
His tag at C-terminus.
Shipping Temperature
Wet Ice
Description
The E.Coli derived recombinant protein contains Soybean P34 Protein full length, having an Mw of 30kDa. The protein is fused to a His tag at C-terminus.
Gene symbol
SOY BEAN P34
Protein size
Recombinant
Product format
Sterile filtered colorless solution. Supplied in 50mM Tris-HCl, pH 8.0 and 60mM NaCl.
Reconstitution and storage
Soybean P34 although stable at 4C for 1 week, should be stored below -18C. Please prevent freeze thaw cycles.
Description of target
The P34 protein is the main allergen for soybean sensitive humans. Soybean protein P34, a thiol protease belonging to the papain family, is a monomeric allergen having an N-terminal amino acid sequence and amino acid composition identical to that of the seed 34kDa protein. It is an insoluble glycoprotein having a pI of 4.5 and a calculated mass of 28.643 Dalton, representing 2–3% of total soybean protein. Upon glycosylation, the mass will be somewhat larger, resulting in a ~32kDa band in non-reduced SDS PAGE gels. It exhibits no enzymatic function due to an absence of the catalytic cysteine. P34 is stored in storage vacuoles of soybean cotyledons.
Purification
Purified by proprietary chromatographic technique.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen