Comparison

Soybean P34 Protein

Item no. OPPA00393
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Proteins Recombinant
Format Liquid
Applications WB, ELISA
Specific against Glycine max
Conjugate/Tag HIS
Purity Protein is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.
Sequence MLTKFTTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMNANRKSPHSHRLGLNKFADITPQEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCDHPPASWDWRKKGVITQVKYQGGCGSGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGCYNGWHYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYT
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Soybean P34,Soybean P34 Protein Recombinant
Similar products Soy Bean P34
Shipping Condition Cool pack
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
His tag at C-terminus.
Shipping Temperature
Wet Ice
Description
The E.Coli derived recombinant protein contains Soybean P34 Protein full length, having an Mw of 30kDa. The protein is fused to a His tag at C-terminus.
Gene symbol
SOY BEAN P34
Protein size
Recombinant
Product format
Sterile filtered colorless solution. Supplied in 50mM Tris-HCl, pH 8.0 and 60mM NaCl.
Reconstitution and storage
Soybean P34 although stable at 4C for 1 week, should be stored below -18C. Please prevent freeze thaw cycles.
Description of target
The P34 protein is the main allergen for soybean sensitive humans. Soybean protein P34, a thiol protease belonging to the papain family, is a monomeric allergen having an N-terminal amino acid sequence and amino acid composition identical to that of the seed 34kDa protein. It is an insoluble glycoprotein having a pI of 4.5 and a calculated mass of 28.643 Dalton, representing 2–3% of total soybean protein. Upon glycosylation, the mass will be somewhat larger, resulting in a ~32kDa band in non-reduced SDS PAGE gels. It exhibits no enzymatic function due to an absence of the catalytic cysteine. P34 is stored in storage vacuoles of soybean cotyledons.
Purification
Purified by proprietary chromatographic technique.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close