FGF 23 Protein

ArtNr	OPPA00636
Hersteller	AVIVA Systems Biology
Menge	2 ug
Kategorie	Oncology By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 90.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence	MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ADHR,FGFN,HYPF,HFTC2,HPDR2,PHPTC
Similar products	FGF 23
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Gene symbol	FGF 23
Protein size	Recombinant
Product format	The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution. Physical appearance: Sterile Filtered white lyophilized powder.
Reconstitution and storage	Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution FGF-23 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target	Recombinant Human Fibroblast Growth Factor-23
Protein accession_num	NP_065689.1
Protein name	Fibroblast growth factor 23

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPPA00636-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 2 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern