« Back
Home /
FGF 23 Protein

FGF 23 Protein

Item no.	OPPA00636
Manufacturer	AVIVA Systems Biology
Amount	2 ug
Category	Oncology By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 90.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence	MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ADHR,FGFN,HYPF,HFTC2,HPDR2,PHPTC
Similar products	FGF 23
Shipping Condition	Room temperature
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Gene symbol	FGF 23
Protein size	Recombinant
Product format	The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution. Physical appearance: Sterile Filtered white lyophilized powder.
Reconstitution and storage	Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution FGF-23 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target	Recombinant Human Fibroblast Growth Factor-23
Protein accession_num	NP_065689.1
Protein name	Fibroblast growth factor 23

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA00636-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 2 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer