IL 1 beta Protein

ArtNr	OPPA00739
Hersteller	AVIVA Systems Biology
Menge	5 ug
Kategorie	Neuroscience Neuroinflammation Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Cell Culture Cytokines
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95.0% as determined by analysis by SDS-PAGE.
Sequence	APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL-1,IL1F2,IL1beta,IL1-BETA
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	amino-terminal hexahistidine tag
Shipping Temperature	Wet Ice
Molecular Weight	22 kDa
Gene symbol	IL1-BETA
Protein size	Recombinant
Product format	Liquid 20mM Tris-HCl (pH 8.0) and 50% glycerol
Reconstitution and storage	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Description of target	Interleukin-1b is a potent pro-inflammatory cytokine produced by a wide variety of cell types including monocytes and macrophages. It displays a broad range of biological activity including activation of B and T cells in response to inflammation and the activation of endothelial cells.
Protein accession_num	NP_000567.1
Protein name	Interleukin-1 beta
Purification	Purified by proprietary chromatographic techniques.
Concentration	1 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPPA00739-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 10 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern