« Back
Home /
IL 1 beta Protein

IL 1 beta Protein

Item no.	OPPA00739
Manufacturer	AVIVA Systems Biology
Amount	5 ug
Category	Neuroscience Neuroinflammation Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Cell Culture Cytokines
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95.0% as determined by analysis by SDS-PAGE.
Sequence	APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL-1,IL1F2,IL1beta,IL1-BETA
Shipping Condition	Cool pack
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	amino-terminal hexahistidine tag
Shipping Temperature	Wet Ice
Molecular Weight	22 kDa
Gene symbol	IL1-BETA
Protein size	Recombinant
Product format	Liquid 20mM Tris-HCl (pH 8.0) and 50% glycerol
Reconstitution and storage	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Description of target	Interleukin-1b is a potent pro-inflammatory cytokine produced by a wide variety of cell types including monocytes and macrophages. It displays a broad range of biological activity including activation of B and T cells in response to inflammation and the activation of endothelial cells.
Protein accession_num	NP_000567.1
Protein name	Interleukin-1 beta
Purification	Purified by proprietary chromatographic techniques.
Concentration	1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA00739-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 10 days

Compare

Add to wishlist

Get an offer