HBsAg preS2 Protein

ArtNr	OPPA00883
Hersteller	AVIVA Systems Biology
Menge	10 ug
Kategorie	Peptides & Proteins Recombinant Proteins ELISA Immunostaining Lateral Flow
Typ	Proteins Recombinant
Format	Liquid
Applikationen	ELISA, LF
Specific against	Virus
Purity	HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining).<br/><b>Purification: </b>HBsAg protein was purified by proprietary chromatographic technique.
Sequence	MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HBsAg preS2,Hepatitis B Surface Antigen,preS2 Recombinant
Similar products	HBsAg preS2
Versandbedingung	Raumtemperatur
Lieferbar
Specificity	Hepatitis B Virus
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Manufacturer - Application Additional Information	1. Immunochromatography (capture and conjugate). 2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2. 3. ELISA.
Gene symbol	HBSAG PRES2
Protein size	Recombinant
Product format	HBsAg protein was lyophilized from 0.2um filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Reconstitution and storage	This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.
Description of target	Recombinant Hepatitis B Surface Antigen preS2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPPA00883-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern