« Back
Home /
HBsAg preS2 Protein

HBsAg preS2 Protein

Item no.	OPPA00883
Manufacturer	AVIVA Systems Biology
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins ELISA Immunostaining Lateral Flow
Type	Proteins Recombinant
Format	Liquid
Applications	ELISA, LF
Specific against	Virus
Purity	HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining).<br/><b>Purification: </b>HBsAg protein was purified by proprietary chromatographic technique.
Sequence	MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HBsAg preS2,Hepatitis B Surface Antigen,preS2 Recombinant
Similar products	HBsAg preS2
Shipping Condition	Room temperature
Available
Specificity	Hepatitis B Virus
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Manufacturer - Application Additional Information	1. Immunochromatography (capture and conjugate). 2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2. 3. ELISA.
Gene symbol	HBSAG PRES2
Protein size	Recombinant
Product format	HBsAg protein was lyophilized from 0.2um filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Reconstitution and storage	This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.
Description of target	Recombinant Hepatitis B Surface Antigen preS2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA00883-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer