Vergleich

HIV-2 gp-36 Protein

ArtNr OPPA00998
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Applikationen WB, ELISA
Specific against Human Immunodeficiency Virus (HIV)
Host E.coli
Purity Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Sequence EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEA
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias HIV-2 gp-36 (390-702 a.a.),HIV-2 gp36 (390-702 a.a.) Recombinant
Similar products HIV-2 gp36 (390-702)
Versandbedingung Gekühlt
Lieferbar
Specificity Human Immunodeficiency Virus Type 2
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Shipping Temperature
Wet Ice
Molecular Weight
34 kDa
Manufacturer - Application Additional Information
HIV-2 gp-36 antigen in ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.
Gene symbol
HIV-2 GP36 (390-702)
Protein size
Recombinant
Product format
Liquid 0.01M Na2CO3, 0.01M Na3EDTA, 0.014M beta-mercaptoethanol, 0.05% Tween-20
Reconstitution and storage
HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Description of target
HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus.
Manufacturer - Specificity
Reactive with human HIV positive serum.
Concentration
1 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen