HIV-2 gp-36 Protein

ArtNr	OPPA00998
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Western Blot ELISA Immunostaining
Typ	Proteins Recombinant
Format	Liquid
Applikationen	WB, ELISA
Specific against	Human Immunodeficiency Virus (HIV)
Host	E.coli
Purity	Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Sequence	EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HIV-2 gp-36 (390-702 a.a.),HIV-2 gp36 (390-702 a.a.) Recombinant
Similar products	HIV-2 gp36 (390-702)
Versandbedingung	Gekühlt
Lieferbar
Specificity	Human Immunodeficiency Virus Type 2
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Wet Ice
Molecular Weight	34 kDa
Manufacturer - Application Additional Information	HIV-2 gp-36 antigen in ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.
Gene symbol	HIV-2 GP36 (390-702)
Protein size	Recombinant
Product format	Liquid 0.01M Na₂CO₃, 0.01M Na₃EDTA, 0.014M beta-mercaptoethanol, 0.05% Tween-20
Reconstitution and storage	HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Description of target	HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus.
Manufacturer - Specificity	Reactive with human HIV positive serum.
Concentration	1 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPPA00998-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 13.11.2025