« Back
Home /
HIV-2 gp-36 Protein

HIV-2 gp-36 Protein

Item no.	OPPA00998
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Western Blot ELISA Immunostaining
Type	Proteins Recombinant
Format	Liquid
Applications	WB, ELISA
Specific against	Human Immunodeficiency Virus (HIV)
Host	E.coli
Purity	Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Sequence	EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HIV-2 gp-36 (390-702 a.a.),HIV-2 gp36 (390-702 a.a.) Recombinant
Similar products	HIV-2 gp36 (390-702)
Shipping Condition	Cool pack
Available
Specificity	Human Immunodeficiency Virus Type 2
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Wet Ice
Molecular Weight	34 kDa
Manufacturer - Application Additional Information	HIV-2 gp-36 antigen in ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.
Gene symbol	HIV-2 GP36 (390-702)
Protein size	Recombinant
Product format	Liquid 0.01M Na₂CO₃, 0.01M Na₃EDTA, 0.014M beta-mercaptoethanol, 0.05% Tween-20
Reconstitution and storage	HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Description of target	HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus.
Manufacturer - Specificity	Reactive with human HIV positive serum.
Concentration	1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA00998-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer