Protein G Protein

ArtNr	OPPA01314
Hersteller	AVIVA Systems Biology
Menge	1 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	other
Purity	>96% as determined by SDS-PAGE and RP-HPLC.
Sequence	LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein G,Protein G Recombinant
Similar products	Protein-G
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Wet Ice
Molecular Weight	22 kDa
Description	Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains amino acids 190-384. The Protein-G migrates on SDS-PAGE around 32 kDa.
Gene symbol	PROTEIN-G
Protein size	Recombinant
Product format	Lyophilized white powder containing no additives
Reconstitution and storage	Reconstitute with deionized water or PBS. Lyophilized Recombinant Protein G, although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution, Protein G should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze/thaw cycles.
Description of target	Recombinant Protein G

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPPA01314-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern