« Back
Home /
Protein G Protein

Protein G Protein

Item no.	OPPA01314
Manufacturer	AVIVA Systems Biology
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
Purity	>96% as determined by SDS-PAGE and RP-HPLC.
Sequence	LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein G,Protein G Recombinant
Similar products	Protein-G
Shipping Condition	Cool pack
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Wet Ice
Molecular Weight	22 kDa
Description	Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains amino acids 190-384. The Protein-G migrates on SDS-PAGE around 32 kDa.
Gene symbol	PROTEIN-G
Protein size	Recombinant
Product format	Lyophilized white powder containing no additives
Reconstitution and storage	Reconstitute with deionized water or PBS. Lyophilized Recombinant Protein G, although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution, Protein G should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze/thaw cycles.
Description of target	Recombinant Protein G

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA01314-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 11/13/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer