Vergleich

Omp Pylori Protein

ArtNr OPPA02479
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Applikationen ELISA, LF
Specific against Bacteria (generic)
Host E.coli
Purity Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Sequence MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Omp Pylori
Similar products Omp Pylori
Versandbedingung Gekühlt
Lieferbar
Specificity Helicobacter pylori
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Shipping Temperature
Wet Ice
Molecular Weight
23 kDa
Manufacturer - Application Additional Information
Can be used for lateral follow product, ELISA assay and vaccine development.
Gene symbol
OMP PYLORI
Protein size
Recombinant
Product format
Liquid 1xPBS (pH 7.4)
Reconstitution and storage
Omp Pylori, although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze/thaw cycles.
Description of target
Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world''s population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection.
Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Purification
Purified by proprietary chromatographic techniques.
Concentration
1.55 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen