Comparison

Omp Pylori Protein

Item no. OPPA02479
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Proteins Recombinant
Format Liquid
Applications ELISA, LF
Specific against Bacteria (generic)
Host E.coli
Purity Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Sequence MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Omp Pylori
Similar products Omp Pylori
Shipping Condition Cool pack
Available
Specificity Helicobacter pylori
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Shipping Temperature
Wet Ice
Molecular Weight
23 kDa
Manufacturer - Application Additional Information
Can be used for lateral follow product, ELISA assay and vaccine development.
Gene symbol
OMP PYLORI
Protein size
Recombinant
Product format
Liquid 1xPBS (pH 7.4)
Reconstitution and storage
Omp Pylori, although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze/thaw cycles.
Description of target
Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world''s population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection.
Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Purification
Purified by proprietary chromatographic techniques.
Concentration
1.55 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Delivery expected until 11/27/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close