« Zurück
Startseite /
Recombinant Toxocara canis 26 kDa secreted antigen (TES-26)

Recombinant Toxocara canis 26 kDa secreted antigen (TES-26)

ArtNr	BM-RPC20674-50ug
Hersteller	Biomatik
Menge	50 UG
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Sequence	QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNT CDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCG LCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQV NCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPD FPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQ PSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQ DSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Protein Familie	Phosphatidylethanolamine-binding protein family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Toxocara excretory-secretory antigen 26 Short name: TES-26
Similar products	Toxocara excretory-secretory antigen 26 Short name: TES-26
Lieferbar
Manufacturer - Conjugate / Tag	Unconjugated, C-Terminal 9Xhis-Tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	27.9 kDa
Expression Region	22-262aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Binds phosphatidylethanolamine.
Subcellular location	Secreted
Function	Binds phosphatidylethanolamine.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	TES-26
Sequence Information	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 UG

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern