« Back
Home /
Recombinant Toxocara canis 26 kDa secreted antigen (TES-26)

Recombinant Toxocara canis 26 kDa secreted antigen (TES-26)

Item no.	BM-RPC20674-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Sequence	QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNT CDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCG LCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQV NCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPD FPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQ PSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQ DSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Protein Family	Phosphatidylethanolamine-binding protein family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Toxocara excretory-secretory antigen 26 Short name: TES-26
Similar products	Toxocara excretory-secretory antigen 26 Short name: TES-26
Available
Manufacturer - Conjugate / Tag	Unconjugated, C-Terminal 9Xhis-Tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	27.9 kDa
Expression Region	22-262aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Binds phosphatidylethanolamine.
Subcellular location	Secreted
Function	Binds phosphatidylethanolamine.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	TES-26
Sequence Information	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 10/2/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer