« Zurück
Startseite /
Recombinant Human E3 ubiquitin-protein ligase MARCH2 (MARCH2)

Recombinant Human E3 ubiquitin-protein ligase MARCH2 (MARCH2)

ArtNr	BM-RPC20610-100ug
Hersteller	Biomatik
Menge	100 UG
Kategorie	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Autophagy
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQ YVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEG ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSY CELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEA VGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETP
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II
Similar products	Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	43 kDa
Expression Region	1-246aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
Subcellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein, Lysosome membrane, Multi-pass membrane protein, Endosome membrane, Multi-pass membrane protein
Function	E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
Activity	Not Tested
Tissue Specificity	Broadly expressed.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	43526
Sequence Information	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 UG

lieferbar

Lieferung vsl. bis 16.10.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern