« Back
Home /
Recombinant Human E3 ubiquitin-protein ligase MARCH2 (MARCH2)

Recombinant Human E3 ubiquitin-protein ligase MARCH2 (MARCH2)

Item no.	BM-RPC20610-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Autophagy
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQ YVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEG ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSY CELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEA VGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETP
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II
Similar products	Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	43 kDa
Expression Region	1-246aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
Subcellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein, Lysosome membrane, Multi-pass membrane protein, Endosome membrane, Multi-pass membrane protein
Function	E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
Activity	Not Tested
Tissue Specificity	Broadly expressed.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	43526
Sequence Information	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 10/16/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer