« Zurück
Home /
Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

Hersteller	Biomatik
Kategorie	Oncology By Cell Type Carcinoma Hematology Myeloma Melanoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis Adenocarcinoma
Typ	Proteins Recombinant
Specific against	Human
Menge	50ug
ArtNr	BM-RPC20685-50ug
Targets	CD262;;HLA-C;;KIR2DL1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Gene Name	KIR2DS3
Alternative Names	MHC class I NK cell receptor Natural killer-associated transcript 7 Short name: NKAT-7 NKAT7
Uniprot	Q14952
Source	Baculovirus
Expression Region	22-245aa
AA Sequence	HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFE HFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMR QDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLY EKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLS TEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTY RCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSP TEPSSKTGNPRHLH
Sequence Info	Extracellular Domain
Tag Info	N-terminal MBP-tagged and C-terminal 6xHis-tagged
Theoretical MW	68.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Function	Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Subcellular location	Cell membrane, Single-pass type I membrane protein
Protein Families	Immunoglobulin superfamily
Paythway	Antigenprocessingandpresentation

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 27.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern