« Back
Home /
Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

Manufacturer	Biomatik
Category	Oncology By Cell Type Carcinoma Hematology Myeloma Melanoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis Adenocarcinoma
Type	Proteins Recombinant
Specific against	Human
Amount	50ug
Item no.	BM-RPC20685-50ug
Targets	CD262;;HLA-C;;KIR2DL1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	KIR2DS3
Alternative Names	MHC class I NK cell receptor Natural killer-associated transcript 7 Short name: NKAT-7 NKAT7
Uniprot	Q14952
Source	Baculovirus
Expression Region	22-245aa
AA Sequence	HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFE HFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMR QDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLY EKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLS TEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTY RCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSP TEPSSKTGNPRHLH
Sequence Info	Extracellular Domain
Tag Info	N-terminal MBP-tagged and C-terminal 6xHis-tagged
Theoretical MW	68.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Function	Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Subcellular location	Cell membrane, Single-pass type I membrane protein
Protein Families	Immunoglobulin superfamily
Paythway	Antigenprocessingandpresentation

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 5/30/2024