« Zurück
Startseite /
Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

ArtNr	BM-RPC20708-100ug
Hersteller	Biomatik
Menge	100 UG
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Enzymes Leukotriene Metabolism
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESR TQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAV LWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGER TQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG SDFENYIKTISTTISPLLLIP
Protein Familie	MAPEG family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FLAP MK-886-binding protein
Similar products	FLAP MK-886-binding protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	34.2 kDa
Expression Region	1-161aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Subcellular location	Nucleus membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Involvement in disease	Ischemic stroke (ISCHSTR)
Function	Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Pathway	FcepsilonRIsignalingpathway
Manufacturer - Gene Name	ALOX5AP
Sequence Information	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 UG

lieferbar

Lieferung vsl. bis 19.02.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern