« Back
Home /
Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Item no.	BM-RPC20708-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Enzymes Leukotriene Metabolism
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESR TQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAV LWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGER TQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG SDFENYIKTISTTISPLLLIP
Protein Family	MAPEG family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FLAP MK-886-binding protein
Similar products	FLAP MK-886-binding protein
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	34.2 kDa
Expression Region	1-161aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Subcellular location	Nucleus membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Involvement in disease	Ischemic stroke (ISCHSTR)
Function	Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Pathway	FcepsilonRIsignalingpathway
Manufacturer - Gene Name	ALOX5AP
Sequence Information	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 10/23/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer