« Zurück
Home /
Recombinant Human Diacylglycerol O-acyltransferase 1 (DGAT1), partial

Recombinant Human Diacylglycerol O-acyltransferase 1 (DGAT1), partial

Hersteller	Biomatik
Kategorie	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Obesity Enzymes Fatty Acid Synthesis
Typ	Proteins Recombinant
Specific against	Human
Menge	50ug
ArtNr	BM-RPC20725-50ug
Targets	DGAT2
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Gene Name	DGAT1
Alternative Names	ACAT-related gene product 1 Acyl-CoA retinol O-fatty-acyltransferase Short name:ARAT Short name: Retinol O-fatty-acyltransferase Diglyceride acyltransferase AGRP1, DGAT
Uniprot	O75907
Source	in vitro E.coli expression system
Expression Region	240-488aa
AA Sequence	TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIR KRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMK PFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHS CLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNI PVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFF HEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQ GNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAP AAEA
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	37.1 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Function	Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Involvement in disease	Diarrhea 7 (DIAR7)
Subcellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families	Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 27.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern