Manufacturer |
Biomatik
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
Amount |
50ug |
Item no. |
BM-RPC20725-50ug |
Targets |
DGAT2 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Gene Name |
DGAT1 |
Alternative Names |
ACAT-related gene product 1 Acyl-CoA retinol O-fatty-acyltransferase Short name:ARAT Short name: Retinol O-fatty-acyltransferase Diglyceride acyltransferase AGRP1, DGAT |
Uniprot |
O75907 |
Source |
in vitro E.coli expression system |
Expression Region |
240-488aa |
AA Sequence |
TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIR KRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMK PFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHS CLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNI PVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFF HEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQ GNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAP AAEA |
Sequence Info |
Partial |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
37.1 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. |
Function |
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. |
Involvement in disease |
Diarrhea 7 (DIAR7) |
Subcellular location |
Endoplasmic reticulum membrane, Multi-pass membrane protein |
Protein Families |
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.