« Zurück
Home /
Recombinant Human Lutropin-choriogonadotropic hormone receptor (LHCGR), partial

Recombinant Human Lutropin-choriogonadotropic hormone receptor (LHCGR), partial

Hersteller	Biomatik
Kategorie	Oncology Neuroscience Neuroinflammation Molecular Targets for Neuroscience By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion By Organ Bladder Cancer Colorectal Cancer Breast Cancer Head & Neck Cancer Testicular & Prostate Cancer Gastric Cancer
Typ	Proteins Recombinant
Specific against	Human
Menge	50ug
ArtNr	BM-RPC23831-50ug
Targets	CD44;;LHCGR;;NR4A1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Gene Name	LHCGR
Alternative Names	Luteinizing hormone receptor Short name: LHR Short name: LSH-R
Uniprot	P22888
Source	Mammalian cell
Expression Region	27-363aa
AA Sequence	EALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPV KVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDN LLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSIC NTGIRKFPDVTKVFSSESNFILEICDNLHITTIPG NAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTS LELKENVHLEKMHNGAFRGATGPKTLDISSTKLQA LPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEA TLTYPSHCCAFRNLPTKEQNFSHSISENFSKQCES TVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTP RCAPEPDAFNPCEDIMGYDFLR
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	41.6 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Function	Receptor for lutropin-choriogonadotropic hormone
Involvement in disease	Familial male precocious puberty (FMPP); Luteinizing hormone resistance (LHR)
Subcellular location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Tissue Specificity	Gonadal and thyroid cells.
Paythway	Calciumsignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 27.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern