« Back
Home /
Recombinant Human Lutropin-choriogonadotropic hormone receptor (LHCGR), partial

Recombinant Human Lutropin-choriogonadotropic hormone receptor (LHCGR), partial

Manufacturer	Biomatik
Category	Oncology Neuroscience Neuroinflammation Molecular Targets for Neuroscience By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion By Organ Bladder Cancer Colorectal Cancer Breast Cancer Head & Neck Cancer Testicular & Prostate Cancer Gastric Cancer
Type	Proteins Recombinant
Specific against	Human
Amount	50ug
Item no.	BM-RPC23831-50ug
Targets	CD44;;LHCGR;;NR4A1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	LHCGR
Alternative Names	Luteinizing hormone receptor Short name: LHR Short name: LSH-R
Uniprot	P22888
Source	Mammalian cell
Expression Region	27-363aa
AA Sequence	EALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPV KVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDN LLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSIC NTGIRKFPDVTKVFSSESNFILEICDNLHITTIPG NAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTS LELKENVHLEKMHNGAFRGATGPKTLDISSTKLQA LPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEA TLTYPSHCCAFRNLPTKEQNFSHSISENFSKQCES TVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTP RCAPEPDAFNPCEDIMGYDFLR
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	41.6 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Function	Receptor for lutropin-choriogonadotropic hormone
Involvement in disease	Familial male precocious puberty (FMPP); Luteinizing hormone resistance (LHR)
Subcellular location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Tissue Specificity	Gonadal and thyroid cells.
Paythway	Calciumsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024