« Zurück
Startseite /
Recombinant Human Protein Wnt-3a (WNT3A)

Recombinant Human Protein Wnt-3a (WNT3A)

ArtNr	BM-RPC26102-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Gene Name	WNT3A
Uniprot	P56704
Source	E.coli
Expression Region	19-352aa
AA Sequence	SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQL RFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNC TTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFA VTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSED IEFGGMVSREFADARENRPDARSAMNRHNNEAGRQ AIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIG DFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYF KVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCN VSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHW CCYVSCQECTRVYDVHTCK
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	43.5 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family. Required for normal embryonic mesoderm development and formation of caudal somites. Required for normal morphogenesis of the developing neural tube. Mediates self-renewal of the stem cells at the bottom on intestinal crypts.
Function	Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
Subcellular location	Secreted, extracellular space, extracellular matrix
Protein Families	Wnt family
Tissue Specificity	Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate.
Paythway	Hipposignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 21.08.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern