« Back
Home /
Recombinant Human Protein Wnt-3a (WNT3A)

Recombinant Human Protein Wnt-3a (WNT3A)

Item no.	BM-RPC26102-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Gene Name	WNT3A
Uniprot	P56704
Source	E.coli
Expression Region	19-352aa
AA Sequence	SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQL RFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNC TTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFA VTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSED IEFGGMVSREFADARENRPDARSAMNRHNNEAGRQ AIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIG DFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYF KVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCN VSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHW CCYVSCQECTRVYDVHTCK
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	43.5 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family. Required for normal embryonic mesoderm development and formation of caudal somites. Required for normal morphogenesis of the developing neural tube. Mediates self-renewal of the stem cells at the bottom on intestinal crypts.
Function	Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
Subcellular location	Secreted, extracellular space, extracellular matrix
Protein Families	Wnt family
Tissue Specificity	Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate.
Paythway	Hipposignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 8/21/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer