« Zurück
Startseite /
Recombinant Human Potassium channel subfamily K member 3 (KCNK3)

Recombinant Human Potassium channel subfamily K member 3 (KCNK3)

ArtNr	BM-RPC26455-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins Cardiovascular Research Ischemia & Reperfusion Injury
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Acid-sensitive potassium channel protein TASK-1 (TWIK-related acid-sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+) channel KT3.1) (TASK) (TASK1)
Similar products	Acid-sensitive potassium channel protein TASK-1 (TWIK-related acid-sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+) channel KT3.1) (TASK) (TASK1)
Lieferbar
Gene Name	KCNK3
Alternative Names	Acid-sensitive potassium channel protein TASK-1 (TWIK-related acid-sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+) channel KT3.1) (TASK) (TASK1)
Uniprot	O14649
Source	in vitro E.coli expression system
Expression Region	1-394aa
AA Sequence	MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEL IERQRLELRQQELRARYNLSQGGYEELERVVLRLK PHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDG GKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLL HRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGA AAFSHYEHWTFFQAYYYCFITLTTIGFGDYVALQK DQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVLR FMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAH TTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWY KSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGG GRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFR GLMKRRSSV
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	50.5 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
Function	pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
Involvement in disease	Pulmonary hypertension, primary, 4 (PPH4)
Subcellular location	Cell membrane, Multi-pass membrane protein
Protein Families	Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity	Widespread expression in adult. Strongest expression in pancreas and placenta. Lower expression in brain, lung, prostate, heart, kidney, uterus, small intestine and colon.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern