« Back
Home /
Recombinant Human Potassium channel subfamily K member 3 (KCNK3)

Recombinant Human Potassium channel subfamily K member 3 (KCNK3)

Item no.	BM-RPC26455-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins Cardiovascular Research Ischemia & Reperfusion Injury
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Acid-sensitive potassium channel protein TASK-1 (TWIK-related acid-sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+) channel KT3.1) (TASK) (TASK1)
Similar products	Acid-sensitive potassium channel protein TASK-1 (TWIK-related acid-sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+) channel KT3.1) (TASK) (TASK1)
Available
Gene Name	KCNK3
Alternative Names	Acid-sensitive potassium channel protein TASK-1 (TWIK-related acid-sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+) channel KT3.1) (TASK) (TASK1)
Uniprot	O14649
Source	in vitro E.coli expression system
Expression Region	1-394aa
AA Sequence	MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEL IERQRLELRQQELRARYNLSQGGYEELERVVLRLK PHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDG GKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLL HRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGA AAFSHYEHWTFFQAYYYCFITLTTIGFGDYVALQK DQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVLR FMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAH TTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWY KSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGG GRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFR GLMKRRSSV
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	50.5 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
Function	pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
Involvement in disease	Pulmonary hypertension, primary, 4 (PPH4)
Subcellular location	Cell membrane, Multi-pass membrane protein
Protein Families	Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity	Widespread expression in adult. Strongest expression in pancreas and placenta. Lower expression in brain, lung, prostate, heart, kidney, uterus, small intestine and colon.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer