« Zurück
Startseite /
Recombinant Human Zinc transporter 8 (SLC30A8)

Recombinant Human Zinc transporter 8 (SLC30A8)

ArtNr	BM-RPC26459-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Solute carrier family 30 member 8 (ZNT8)
Similar products	Solute carrier family 30 member 8 (ZNT8)
Lieferbar
Gene Name	SLC30A8
Alternative Names	Solute carrier family 30 member 8 (ZNT8)
Uniprot	Q8IWU4
Source	in vitro E.coli expression system
Expression Region	1-369aa
AA Sequence	MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKD QCPRERPEELESGGMYHCHSGSKPTEKGANEYAYA KWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAA HLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAE ILGALLSILCIWVVTGVLVYLACERLLYPDYQIQA TVMIIVSSCAVAANIVLTVVLHQRCLGHNHKEVQA NASVRAAFVHALGDLFQSISVLISALIIYFKPEYK IADPICTFIFSILVLASTITILKDFSILLMEGVPK SLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVIL SAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQ MESPVDQDPDCLFCEDPCD
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	43.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Function	Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Subcellular location	Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Multi-pass membrane protein
Protein Families	Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Tissue Specificity	In the endocrine pancreas, expressed in insulin-producing beta cells. Expressed at relatively high levels in subcutaneous fat tissue from lean persons; much lower levels in visceral fat, whether from lean or obese individuals, and in subcutaneous fat tissue from obese individuals. Expressed in peripheral blood mononuclear cells, including T-cells and B-cells, with great variation among individuals ranging from negative to strongly positive.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 02.10.2025