« Back
Home /
Recombinant Human Zinc transporter 8 (SLC30A8)

Recombinant Human Zinc transporter 8 (SLC30A8)

Item no.	BM-RPC26459-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Solute carrier family 30 member 8 (ZNT8)
Similar products	Solute carrier family 30 member 8 (ZNT8)
Available
Gene Name	SLC30A8
Alternative Names	Solute carrier family 30 member 8 (ZNT8)
Uniprot	Q8IWU4
Source	in vitro E.coli expression system
Expression Region	1-369aa
AA Sequence	MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKD QCPRERPEELESGGMYHCHSGSKPTEKGANEYAYA KWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAA HLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAE ILGALLSILCIWVVTGVLVYLACERLLYPDYQIQA TVMIIVSSCAVAANIVLTVVLHQRCLGHNHKEVQA NASVRAAFVHALGDLFQSISVLISALIIYFKPEYK IADPICTFIFSILVLASTITILKDFSILLMEGVPK SLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVIL SAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQ MESPVDQDPDCLFCEDPCD
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	43.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Function	Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Subcellular location	Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Multi-pass membrane protein
Protein Families	Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Tissue Specificity	In the endocrine pancreas, expressed in insulin-producing beta cells. Expressed at relatively high levels in subcutaneous fat tissue from lean persons; much lower levels in visceral fat, whether from lean or obese individuals, and in subcutaneous fat tissue from obese individuals. Expressed in peripheral blood mononuclear cells, including T-cells and B-cells, with great variation among individuals ranging from negative to strongly positive.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer