« Zurück
Startseite /
Recombinant Human ER membrane protein complex subunit 4 (EMC4)

Recombinant Human ER membrane protein complex subunit 4 (EMC4)

ArtNr	BM-RPC26461-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Oncology By Cell Type Carcinoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Proliferation
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cell proliferation-inducing gene 17 protein (Transmembrane protein 85) (TMEM85)
Similar products	Cell proliferation-inducing gene 17 protein (Transmembrane protein 85) (TMEM85)
Lieferbar
Gene Name	EMC4
Alternative Names	Cell proliferation-inducing gene 17 protein (Transmembrane protein 85) (TMEM85)
Uniprot	Q5J8M3
Source	in vitro E.coli expression system
Expression Region	2-183aa
AA Sequence	TAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGS GQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWD IALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMA WRPIQALMAISATFKMLESSSQKFLQGLVYLIGNL MGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEF SGGGLLL
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	26.0 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	May mediate anti-apoptotic activity.
Function	May mediate anti-apoptotic activity.
Subcellular location	Membrane, Multi-pass membrane protein
Protein Families	EMC4 family
Tissue Specificity	Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 21.08.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern