« Back
Home /
Recombinant Human ER membrane protein complex subunit 4 (EMC4)

Recombinant Human ER membrane protein complex subunit 4 (EMC4)

Item no.	BM-RPC26461-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Oncology By Cell Type Carcinoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Proliferation
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cell proliferation-inducing gene 17 protein (Transmembrane protein 85) (TMEM85)
Similar products	Cell proliferation-inducing gene 17 protein (Transmembrane protein 85) (TMEM85)
Available
Gene Name	EMC4
Alternative Names	Cell proliferation-inducing gene 17 protein (Transmembrane protein 85) (TMEM85)
Uniprot	Q5J8M3
Source	in vitro E.coli expression system
Expression Region	2-183aa
AA Sequence	TAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGS GQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWD IALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMA WRPIQALMAISATFKMLESSSQKFLQGLVYLIGNL MGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEF SGGGLLL
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	26.0 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	May mediate anti-apoptotic activity.
Function	May mediate anti-apoptotic activity.
Subcellular location	Membrane, Multi-pass membrane protein
Protein Families	EMC4 family
Tissue Specificity	Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/21/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer