Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN) (Active)

Interleukin-36 Receptor Antagonist Protein, FIL1 Delta, IL-1-Related Protein 3, IL-1RP3, Interleukin-1 HY1, IL-1HY1, Interleukin-1 Delta, IL-1 Delta, Interleukin-1 Family Member 5, IL-1F5, Interleukin-1 Receptor Antagonist Homolog 1, IL-1ra Homolog 1, Interleukin-1-Like Protein 1, IL-1L1, IL36RN, FIL1D, IL1F5, IL1HY1, IL1L1, IL1RP3

E.coli

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGK VIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDM GLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG GWNAPITDFYFQQCD

Tag-Free

>95% as determined by SDS-PAGE.

Less than 1.0 EU/ug as determined by LAL method.

Ice packs

1 year

Human Interleukin-36 Receptor Antagonist (IL-36RN) is a secreted protein which belongs to the Interleukin 1 cytokine family (IL-1 family). IL-36RN is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RN is also detected in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. IL-36RN is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to Interleukin 1 family member 9 (IL1F9). Dysregulated expression of novel agonistic and antagonistic IL-1 family member ligands can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders. Human and mouse IL-36RN share 90% sequence identity.

Psoriasis 14, pustular (PSORS14)

IL-1 family