Comparison

Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN) (Active)

Item no. BM-RPC26887-1mg
Manufacturer Biomatik
Amount 1mg
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-36 Receptor Antagonist Protein, FIL1 Delta, IL-1-Related Protein 3, IL-1RP3, Interleukin-1 HY1, IL-1HY1, Interleukin-1 Delta, IL-1 Delta, Interleukin-1 Family Member 5, IL-1F5, Interleukin-1 Receptor Antagonist Homolog 1, IL-1ra Homolog 1, Int
Similar products IL1F5, IL36RN, FIL1D, IL1HY1, IL1L1, IL1RP3, Interleukin-1 HY1, IL-1RP3, IL-1L1, IL-1F5, Interleukin-36 Receptor Antagonist Protein, FIL1 Delta, IL-1-Related Protein 3, IL-1HY1, Interleukin-1 Delta, IL-1 Delta, Interleukin-1 Family Member 5, Interleukin-1 Receptor Antagonist Homolog 1, IL-1ra Homolog 1, Interleukin-1-Like Protein 1
Available
Gene Name
IL36RN
Alternative Names
Interleukin-36 Receptor Antagonist Protein, FIL1 Delta, IL-1-Related Protein 3, IL-1RP3, Interleukin-1 HY1, IL-1HY1, Interleukin-1 Delta, IL-1 Delta, Interleukin-1 Family Member 5, IL-1F5, Interleukin-1 Receptor Antagonist Homolog 1, IL-1ra Homolog 1, Interleukin-1-Like Protein 1, IL-1L1, IL36RN, FIL1D, IL1F5, IL1HY1, IL1L1, IL1RP3
Uniprot
Q9UBH0
Source
E.coli
Expression Region
1-155aa
AA Sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGK VIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDM GLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG GWNAPITDFYFQQCD
Sequence Info
Full Length
Tag Info
Tag-Free
Theoretical MW
16.9 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit IL-36 alpha, IL-36 beta or IL-36 gamma -induced IL-8 secretion in A431 human epithelial carcinoma cells is less than 500 ng/ml in the presence of 10 ng/mL of recombinant human IL-36 beta.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Human Interleukin-36 Receptor Antagonist (IL-36RN) is a secreted protein which belongs to the Interleukin 1 cytokine family (IL-1 family). IL-36RN is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RN is also detected in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. IL-36RN is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to Interleukin 1 family member 9 (IL1F9). Dysregulated expression of novel agonistic and antagonistic IL-1 family member ligands can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders. Human and mouse IL-36RN share 90% sequence identity.
Function
Inhibits the activity of interleukin-36 (IL36A, IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Involvement in disease
Psoriasis 14, pustular (PSORS14)
Subcellular location
Secreted
Protein Families
IL-1 family
Tissue Specificity
Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close