« Zurück
Home /
Recombinant Human C-C chemokine receptor type 2 (CCR2) (Active)

Recombinant Human C-C chemokine receptor type 2 (CCR2) (Active)

Hersteller	Biomatik
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Cholesterol & Lipid Metabolism Molecular Targets for Neuroscience By Cell Type Carcinoma Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins Cardiovascular Research Atherosclerosis
Typ	Proteins Recombinant
Specific against	Human
Menge	100ug
ArtNr	BM-RPC27048-100ug
Targets	CCL2;;CD192;;CXCR1;;CXCR4
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Gene Name	CCR2
Alternative Names	Monocyte chemoattractant protein 1 receptor Short name:MCP-1-R CMKBR2
Uniprot	P41597
Source	in vitro E.coli expression system
Expression Region	1-374aa
AA Sequence	MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKF DVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANE WVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPG IIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVI FTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCEST SQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSL FHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL LDGRGKGKSIGRAPEASLQDKEGA
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	45.4 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized CCR2 at 1 ug/ml can bind human CCL2, the EC50 of human CCL2 protein is 41.51-83.15 ug/ml.
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Receptor for the CCL2, CCL7 and CCL13 chemokines. Receptor for the beta-defensin DEFB106A/DEFB106B. Transduces a signal by increasing intracellular calcium ion levels. Upon CCL2 ligation, mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (Probable).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 27.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern