« Back
Home /
Recombinant Human C-C chemokine receptor type 2 (CCR2) (Active)

Recombinant Human C-C chemokine receptor type 2 (CCR2) (Active)

Manufacturer	Biomatik
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Cholesterol & Lipid Metabolism Molecular Targets for Neuroscience By Cell Type Carcinoma Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins Cardiovascular Research Atherosclerosis
Type	Proteins Recombinant
Specific against	Human
Amount	100ug
Item no.	BM-RPC27048-100ug
Targets	CCL2;;CD192;;CXCR1;;CXCR4
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	CCR2
Alternative Names	Monocyte chemoattractant protein 1 receptor Short name:MCP-1-R CMKBR2
Uniprot	P41597
Source	in vitro E.coli expression system
Expression Region	1-374aa
AA Sequence	MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKF DVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANE WVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPG IIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVI FTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCEST SQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSL FHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL LDGRGKGKSIGRAPEASLQDKEGA
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	45.4 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized CCR2 at 1 ug/ml can bind human CCL2, the EC50 of human CCL2 protein is 41.51-83.15 ug/ml.
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Receptor for the CCL2, CCL7 and CCL13 chemokines. Receptor for the beta-defensin DEFB106A/DEFB106B. Transduces a signal by increasing intracellular calcium ion levels. Upon CCL2 ligation, mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (Probable).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/27/2024