« Zurück
Startseite /
Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51 (FCGRT), partial

Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51 (FCGRT), partial

ArtNr	BM-RPC23894-50ug
Hersteller	Biomatik
Menge	50 UG
Kategorie	Oncology By Cell Type Peptides & Proteins Recombinant Proteins Adenocarcinoma
Typ	Proteins Recombinant
Specific against	Monkey (Cynomolgus, Simian)
Sequence	AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQY LSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRI KEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSV PTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQR WQQQDKAANKELTFLLFSCPHRLREHLERGRGNLE WKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQL RFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSG DEH
Protein Familie	Immunoglobulin superfamily
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Similar products	IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Lieferbar
Manufacturer - Conjugate / Tag	C-terminal Flag-Myc-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	33.4 kDa
Expression Region	24-297aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus .
Subcellular location	Cell membrane, Single-pass type I membrane protein
Function	Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity). Possible role in transfer of immunoglobulin G from mother to fetus (By similarity).
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	FCGRT
Sequence Information	Extracellular Domain

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 UG

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern