« Back
Home /
Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51 (FCGRT), partial

Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51 (FCGRT), partial

Item no.	BM-RPC23894-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Oncology By Cell Type Peptides & Proteins Recombinant Proteins Adenocarcinoma
Type	Proteins Recombinant
Specific against	Monkey (Cynomolgus, Simian)
Sequence	AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQY LSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRI KEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSV PTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQR WQQQDKAANKELTFLLFSCPHRLREHLERGRGNLE WKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQL RFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSG DEH
Protein Family	Immunoglobulin superfamily
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Similar products	IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Available
Manufacturer - Conjugate / Tag	C-terminal Flag-Myc-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	33.4 kDa
Expression Region	24-297aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus .
Subcellular location	Cell membrane, Single-pass type I membrane protein
Function	Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity). Possible role in transfer of immunoglobulin G from mother to fetus (By similarity).
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	FCGRT
Sequence Information	Extracellular Domain

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 9/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer