« Zurück
Startseite /
Recombinant Mouse Cell surface hyaluronidase (Tmem2), partial

Recombinant Mouse Cell surface hyaluronidase (Tmem2), partial

ArtNr	BM-RPC26043-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Transmembrane protein 2 (Kiaa1412)
Similar products	Transmembrane protein 2 (Kiaa1412)
Lieferbar
Gene Name	Tmem2
Alternative Names	Transmembrane protein 2 (Kiaa1412)
Uniprot	Q5FWI3
Source	Yeast
Expression Region	104-250aa
AA Sequence	SSKYAPDENCPDQNPRLRNWDPGQDSAKHIVIKEG DLFRLTSDATVDSIVIQDGGLLVFGDDKDGSKNIT LRTRYILIQDGGALHIGAEKCRYRSKATITLYGKS DERESMPIFGKKFIGVEAGGTLELHGAQRTSWTML ARTLHSS
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	18.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments. Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling. Is very specific to hyaluronan; not able to cleave chondroitin sulfate or dermatan sulfate.
Function	Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments (By similarity). Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling (By similarity). Is very specific to hyaluronan; not able to cleave chondroitin sulfate or dermatan sulfate (By similarity).
Subcellular location	Cell membrane, Single-pass type II membrane protein
Protein Families	TMEM2 family
Tissue Specificity	Widely expressed.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern