« Back
Home /
Recombinant Mouse Cell surface hyaluronidase (Tmem2), partial

Recombinant Mouse Cell surface hyaluronidase (Tmem2), partial

Item no.	BM-RPC26043-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Transmembrane protein 2 (Kiaa1412)
Similar products	Transmembrane protein 2 (Kiaa1412)
Available
Gene Name	Tmem2
Alternative Names	Transmembrane protein 2 (Kiaa1412)
Uniprot	Q5FWI3
Source	Yeast
Expression Region	104-250aa
AA Sequence	SSKYAPDENCPDQNPRLRNWDPGQDSAKHIVIKEG DLFRLTSDATVDSIVIQDGGLLVFGDDKDGSKNIT LRTRYILIQDGGALHIGAEKCRYRSKATITLYGKS DERESMPIFGKKFIGVEAGGTLELHGAQRTSWTML ARTLHSS
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	18.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments. Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling. Is very specific to hyaluronan; not able to cleave chondroitin sulfate or dermatan sulfate.
Function	Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments (By similarity). Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling (By similarity). Is very specific to hyaluronan; not able to cleave chondroitin sulfate or dermatan sulfate (By similarity).
Subcellular location	Cell membrane, Single-pass type II membrane protein
Protein Families	TMEM2 family
Tissue Specificity	Widely expressed.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer