« Zurück
Startseite /
Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit A (ctfA)

Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit A (ctfA)

ArtNr	BM-RPC26066-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Acetoacetyl-CoA:acetate/butyrate:CoA transferase subunit A (Coat A)
Similar products	Acetoacetyl-CoA:acetate/butyrate:CoA transferase subunit A (Coat A)
Lieferbar
Gene Name	ctfA
Alternative Names	Acetoacetyl-CoA:acetate/butyrate:CoA transferase subunit A (Coat A)
Uniprot	P33752
Source	E.coli
Expression Region	1-218aa
AA Sequence	MNSKIIRFENLRSFFKDGMTIMIGGFLNCGTPTKL IDFLVNLNIKNLTIISNDTCYPNTGIGKLISNNQV KKLIASYIGSNPDTGKKLFNNELEVELSPQGTLVE RIRAGGSGLGGVLTKTGLGTLIEKGKKKISINGTE YLLELPLTADVALIKGSIVDEAGNTFYKGTTKNFN PYMAMAAKTVIVEAENLVSCEKLEKEKAMTPGVLI NYIVKEPA
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	30.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.
Function	Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.
Protein Families	3-oxoacid CoA-transferase subunit A family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 09.10.2025