« Back
Home /
Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit A (ctfA)

Recombinant Clostridium acetobutylicum Butyrate--acetoacetate CoA-transferase subunit A (ctfA)

Item no.	BM-RPC26066-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Acetoacetyl-CoA:acetate/butyrate:CoA transferase subunit A (Coat A)
Similar products	Acetoacetyl-CoA:acetate/butyrate:CoA transferase subunit A (Coat A)
Available
Gene Name	ctfA
Alternative Names	Acetoacetyl-CoA:acetate/butyrate:CoA transferase subunit A (Coat A)
Uniprot	P33752
Source	E.coli
Expression Region	1-218aa
AA Sequence	MNSKIIRFENLRSFFKDGMTIMIGGFLNCGTPTKL IDFLVNLNIKNLTIISNDTCYPNTGIGKLISNNQV KKLIASYIGSNPDTGKKLFNNELEVELSPQGTLVE RIRAGGSGLGGVLTKTGLGTLIEKGKKKISINGTE YLLELPLTADVALIKGSIVDEAGNTFYKGTTKNFN PYMAMAAKTVIVEAENLVSCEKLEKEKAMTPGVLI NYIVKEPA
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	30.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.
Function	Involved in solventogenic switch which allows C.acetobutylicum to uptake acid and produce solvents. Acts mainly to detoxify the medium by removing the acetate and butyrate excreted earlier in the fermentation.
Protein Families	3-oxoacid CoA-transferase subunit A family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 10/9/2025

Compare

Add to wishlist

Get an offer

Request delivery time