« Zurück
Home /
Recombinant Rat Fatty acid-binding protein, heart (Fabp3)

Recombinant Rat Fatty acid-binding protein, heart (Fabp3)

Hersteller	Biomatik
Kategorie	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Status Necrosis Lipid & Fatty Acid Transport
Typ	Proteins Recombinant
Specific against	Rat
Menge	50ug
ArtNr	BM-RPC23821-50ug
Targets	FABP3
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Gene Name	FABP3
Alternative Names	Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP
Uniprot	P07483
Source	Mammalian cell
Expression Region	2-133aa
AA Sequence	ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASM TKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEF DEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLT RELSDGKLILTLTHGNVVSTRTYEKEA
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	18.6 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Function	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Subcellular location	Cytoplasm
Protein Families	Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity	Heart, but also skeletal muscle, kidney, brain and mammary gland.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 27.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern