« Back
Home /
Recombinant Rat Fatty acid-binding protein, heart (Fabp3)

Recombinant Rat Fatty acid-binding protein, heart (Fabp3)

Manufacturer	Biomatik
Category	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Status Necrosis Lipid & Fatty Acid Transport
Type	Proteins Recombinant
Specific against	Rat
Amount	50ug
Item no.	BM-RPC23821-50ug
Targets	FABP3
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	FABP3
Alternative Names	Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP
Uniprot	P07483
Source	Mammalian cell
Expression Region	2-133aa
AA Sequence	ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASM TKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEF DEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLT RELSDGKLILTLTHGNVVSTRTYEKEA
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	18.6 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Function	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Subcellular location	Cytoplasm
Protein Families	Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity	Heart, but also skeletal muscle, kidney, brain and mammary gland.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024